| DDB(4) | Device Drivers Manual | DDB(4) |
ddb —
options DDB
To enable history editing:
options DDB_HISTORY_SIZE=integer
To disable entering ddb upon kernel panic:
options DDB_ONPANIC=0
To enable teeing all ddb output to the
kernel msgbuf:
options DDB_TEE_MSGBUF=1
To specify commands which will be executed on each entry to
ddb:
options DDB_COMMANDONENTER="trace;show
registers" In this case, "trace" and then "show
registers" will be executed automatically.
To enable extended online help:
options DDB_VERBOSE_HELP.
ddb is the in-kernel debugger. It may be entered at any
time via a special key sequence, and optionally may be invoked when the kernel
panics.
DDB_ONPANIC is set to 0,
ddb will be activated whenever the kernel would
otherwise panic.
ddb may also be activated from the
console. In general, sending a break on a serial console will activate
ddb. There are also key sequences for each port that
will activate ddb from the keyboard:
The key sequence to activate ddb can be
changed by modifying “hw.cnmagic” with
sysctl(8). If the console is
not dedicated to ddb the sequence should not be
easily typed by accident. In addition, ddb may be
explicitly activated by the debugging code in the kernel if
DDB is configured.
Commands can be automatically run when ddb
is entered by using options DDB_COMMANDONENTER or by
setting ddb.commandonenter with
sysctl(8). Multiple commands
can be separated by a semi-colon.
command[/modifier]
address [,count]The current memory location being edited is referred to as dot, and the next location is next. They are displayed as hexadecimal numbers.
Commands that examine and/or modify memory update dot to the address of the last line examined or the last location modified, and set next to the next location to be examined or modified. Other commands don't change dot, and set next to be the same as dot.
A blank line repeats the previous command from the address
next with the previous count
and no modifiers. Specifying address sets
dot to the address. If address is
omitted, dot is used. A missing
count is taken to be 1 for printing commands, and
infinity for stack traces.
The syntax:
,countrepeats the previous command, just as a blank line does, but with
the specified count.
ddb has a
more(1)-like functionality; if a
number of lines in a command's output exceeds the number defined in the
lines variable, then ddb
displays “--db more--” and waits for a response, which may be
one of:
qYou can set lines variable to zero to disable this feature.
If ddb history editing is enabled (by
defining the
options
DDB_HISTORY_SIZE=numnum commands
is kept. The history can be manipulated with the following key sequences:
ddb supports the following commands:
!address([expression[,...])]call.break[/u]
address[,count]delete the breakpoint, or to add conditions to it.
If /u is specified, set a breakpoint
at a user-space address. Without /u,
address is considered to be in the kernel-space,
and an address in the wrong space will be rejected, and an error message
will be emitted. This modifier may only be used if it is supported by
machine dependent routines.
Warning: if a user text is shadowed by a normal user-space debugger, user-space breakpoints may not work correctly. Setting a breakpoint at the low-level code paths may also cause strange behavior.
bt[/ul]
[frame-address][,count]trace.bt/t[/ul]
[pid][,count]trace/t.bt/a[/ul]
[lwpaddr][,count]trace/a.call
address([expression[,...])]continue[/c]/c is specified, count instructions while
executing. Some machines (e.g., pmax) also count loads and stores.
Warning: when counting, the debugger is really silently single-stepping. This means that single-stepping on low-level may cause strange behavior.
delete
address |
#numberbreak, or by
the breakpoint number returned by break if it's
prefixed with ‘#’.dmesg
[count]dwatch
addresswatch command.examine[/modifier]
address[,count]examine is used.
The valid format characters for modifier are:
bhlLaAxzodurcsmiIkill
pid[,signal_number]trace/t command for details). If
signal_number isn't specified, the SIGTERM signal is
sent.match[/p]next.next[/p]/p is
specified, print the call nesting depth and the cumulative instruction
count at each call or return. Otherwise, only print when the matching
return is hit.print[/axzodurc]
address [address ...]examine. Valid modifiers are:
/a, /x,
/z, /o,
/d, /u,
/r, and /c (as per
examine). If no modifier is specified, the most
recent one specified is used. address may be a
string, and is printed “as-is”. For example:
print/x "eax = " $eax "\necx = " $ecx "\n"
will produce:
eax = xxxxxx
ecx = yyyyyy
ps[/a][/n][/w][/l]show all procs.reboot
[flags]| Value | Name | Description |
| 0x1 | RB_ASKNAME | Ask for file name to reboot from |
| 0x2 | RB_SINGLE | Reboot to single user mode |
| 0x4 | RB_NOSYNC | Don't sync before reboot |
| 0x8 | RB_HALT | Halt instead of reboot |
| 0x40 | RB_KDB | Boot into kernel debugger |
| 0x100 | RB_DUMP | Dump unconditionally before reboot |
| 0x808 | RB_POWERDOWN | Power off (or at least halt) |
Note: Limitations of the command line interface preclude specification of a boot string.
search[/bhl]
address value
[mask] [,count]examine. Valid modifiers are:
/b, /h, and
/l. If no modifier is specified,
/l is used.
This command might fail in interesting ways if it doesn't find
value. This is because ddb
doesn't always recover from touching bad memory. The optional
count limits the search.
set
$variable
[=] expressionshow
all calloutshow
all locks[/t]/t is specified, stack traces of LWPs holding
locks are also printed. This command is only useful if a kernel is
compiled with options LOCKDEBUG.show
all pagesshow page.show
all pools[/clp]show pool.show all procs[/a][/n][/w][/l]/n/ashow map command./w/lshow
routesAF_INET routing table. This
command is available only on systems which support inet.show
breaksshow
buf[/f]
address/f does nothing at this time.show
event[/f][/i][/m][/t]/f/i/m/tIf none of /i,
/m, or /t are specified,
all are shown. You can combine any of these. For example, the modifier
/itf will select both interrupt and trap events,
including those that are non-zero.
show
files addressshow all procs /a command. If the kernel is
compiled with options LOCKDEBUG then details about
the locking of the underlying uvm object will also be displayed.show
lock addressoptions LOCKDEBUG.show
lockstatsoptions LOCKDEBUG.show
map[/f]
address/f is specified, the complete map is printed.show
mount[/f]
address/f is specified, the complete vnode list is
printed.show
mbuf[/cdv]
addressshow
ncache addressshow
object[/f]
address/f is specified, the complete object is
printed.show
page[/f]
address/f is specified, the complete page is
printed.show
panicshow
pool[/clp]
addressshow
proc[/ap] address |
pidshow
registers[/u]/u is specified,
display user registers instead of kernel registers or the currently save
one.
Warning: support for /u is machine
dependent. If not supported, incorrect information will be
displayed.
show
sched_qsshow
socket[/ampv]show
uvmexpshow
kernhist[/i]
[addr[,count]]/i is specified, display
information about the named history or all histories, instead of history
entries. If count is specified, only the last
count entries will be displayed. Currently the
count handling is only performed if a single history
is requested. This command is available only if a kernel is compiled with
one or more of the kernel history options
KERNHIST, SYSCALL_DEBUG,
USB_DEBUG, BIOHIST, or
UVMHIST.show
vnode[/f]
address/f is specified, the complete vnode is
printed.show
vnode_lock[/f]
address/f is specified, the complete vnode is
printed.show
watchessifting[/F]
string/F is specified, a character is displayed
immediately after each symbol name indicating the type of symbol.
For a.out(5)-format symbol tables, absolute symbols display @, text segment symbols display *, data segment symbols display +, BSS segment symbols display -, and filename symbols display /. For ELF-format symbol tables, object symbols display +, function symbols display *, section symbols display &, and file symbols display /.
To sift for a string beginning with a number, escape the first character with a backslash as:
sifting \386
step[/p]
[,count]/p is specified, print each instruction at each
step. Otherwise, only print the last instruction.
Warning: depending on the machine type, it may not be possible to single-step through some low-level code paths or user-space code. On machines with software-emulated single-stepping (e.g., pmax), stepping through code executed by interrupt handlers will probably do the wrong thing.
synctrace[/u[l]]
[frame-address][,count]/u is specified, trace user-space, otherwise trace
kernel-space. count is the number of frames to be
traced. If count is omitted, all frames are printed.
If /l is specified, the trace is printed and also
stored in the kernel message buffer.
Warning: user-space stack trace is valid only if the machine dependent code supports it.
trace/t[l]
[pid][,count]ps displays pids in decimal; prefix
pid with ‘0t’ to force it to be
interpreted as decimal (see VARIABLES
section for radix). If /l is specified, the trace
is printed and also stored in the kernel message buffer.
Warning: trace by pid is valid only if the machine dependent code supports it.
trace/a[l]
[lwpaddr][,count]/l is specified, the trace is
printed and also stored in the kernel message buffer.
Warning: trace by LWP address is valid only if the machine dependent code supports it.
until[/p]/p
is specified, print the call nesting depth and the cumulative instruction
count at each call or return. Otherwise, only print when the matching
return is hit.watch
address[,size]If you specify a wrong space address, the request is rejected with an error message.
Warning: attempts to watch wired kernel memory may cause an unrecoverable error in some systems such as i386. Watchpoints on user addresses work the best.
whatis
addresswrite[/bhlBHL]
address expression
[expression ...]examine. Valid modifiers are:
/b, /h, and
/l. If no modifier is specified,
/l is used.
Specifying the modifiers in upper case,
/B, /H,
/L, will prevent ddb
from reading the memory location first, which is useful for avoiding
side effects when writing to I/O memory regions.
Warning: since there is no delimiter between expressions, strange things may occur. It's best to enclose each expression in parentheses.
x[/modifier]
address[,count]examine.ddb into the
NetBSD kernel for any given port can also add machine
specific commands to the ddb command parser. All of
these commands are preceded by the command word machine to
indicate that they are part of the machine-specific command set (e.g.
machine reboot). Some of these commands are:
cpucpuinfoframelwpptesysregwatchcpucpuframeframecpuvectorctxpvresettftlbdcruserctxcpudtlbdtsbkmapextractfpstateitlbitsblwppcbpctxpagephyspmapprocprompvsirstacktftstraptracewatchwindowcpuddb accesses registers and variables as
$name. Register names are as per
the show registers command. Some variables are
suffixed with numbers, and may have a modifier following a colon immediately
after the variable name. For example, register variables may have a
‘u’ modifier to indicate user register (e.g.,
$eax:u).
Built-in variables currently supported are:
ddb is entered on panic.ddb from the console (by break signal or special
key sequence). If the kernel configuration option
options
DDB_FROMCONSOLE=0more
feature. When this variable is set to zero the
more feature is disabled.'symbol'+offset unless
offset is greater than
maxoff.ddb wraps the
current line by printing new line when maxwidth
column is reached. When this variable is set to zero
ddb doesn't perform any wrapping.ddb will
be invoked when the kernel panics. If the kernel configuration option
options
DDB_ONPANIC=0ddb being entered. Setting
onpanic to -1 suppresses the stack trace before
reboot.ddb output will not only be displayed on screen
but also be fed to the msgbuf. The default of the variable can be set
using the kernel configuration option
options
DDB_TEE_MSGBUF=1ddb output from a crash
investigation. This option is more generic than the /l command modifier
possible for selected commands as discussed above to log the output.
Mixing both /l and this setting can give double loggings.65535 (all frames), useful value around
10.All built-in variables are accessible via sysctl(3).
ddb are:
emulator::mach_msg_trap) to specify other than
kernel symbols..+..examine or
write commands."$name#*exprddb kernel debugger was written as part of the MACH
project at Carnegie-Mellon University.
| July 21, 2019 | NetBSD 9.5 |